Recombinant Human HES3 Protein, GST-tagged

• Cat.No.: HES3-4703H
• Product Overview: Human HES3 full-length ORF ( AAI56116.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HES3 (Hes Family BHLH Transcription Factor 3) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and protein dimerization activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 20.5 kDa
• AA Sequence: MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HES3 hes family bHLH transcription factor 3 [ Homo sapiens (human) ]
• Official Symbol: HES3
• Synonyms: HES3; hes family bHLH transcription factor 3; bHLHb43; transcription factor HES-3; class B basic helix-loop-helix protein 43; hairy and enhancer of split 3
• Gene ID: 390992
• mRNA Refseq: NM_001024598
• Protein Refseq: NP_001019769
• MIM: 609971
• UniProt ID: Q5TGS1