Recombinant Human HERC4 Protein, GST-tagged

• Cat.No.: HERC4-4692H
• Product Overview: Human HERC4 partial ORF ( NP_071362, 341 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: VKGNWYPYNGQCLPDIDSEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HERC4 HECT and RLD domain containing E3 ubiquitin protein ligase 4 [ Homo sapiens ]
• Official Symbol: HERC4
• Synonyms: HERC4; HECT and RLD domain containing E3 ubiquitin protein ligase 4; hect domain and RLD 4; probable E3 ubiquitin-protein ligase HERC4; DKFZP564G092; KIAA1593; HECT domain and RCC1-like domain-containing protein 4; DKFZp564G092
• Gene ID: 26091
• mRNA Refseq: NM_015601
• Protein Refseq: NP_056416
• MIM: 609248
• UniProt ID: Q5GLZ8