Recombinant Human HEPN1 Protein, GST-tagged

• Cat.No.: HEPN1-4690H
• Product Overview: Human HEPN1 full-length ORF ( AAI56584.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is expressed in the liver, and encodes a short peptide that is localized predominantly to the cytoplasm. Transient transfection studies showed that expression of this gene significantly inhibited cell growth, and it may have a role in apoptosis. Expression of this gene is downregulated or lost in hepatocellular carcinomas (HCC), suggesting that loss of this gene is involved in carcinogenesis of hepatocytes (PMID:12971969). Also to note is that this gene maps to the 3'-noncoding region of HEPACAM gene (GeneID:220296) on the antisense strand (PMID:15885354). [provided by RefSeq, Aug 2011]
• Molecular Mass: 36.08 kDa
• AA Sequence: MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQRPSLFILMLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HEPN1 hepatocellular carcinoma, down-regulated 1 [ Homo sapiens (human) ]
• Official Symbol: HEPN1
• Synonyms: HEPN1; hepatocellular carcinoma, down-regulated 1; putative cancer susceptibility gene HEPN1 protein; HEPACAM opposite strand 1; cancer susceptibility gene HEPN1
• Gene ID: 641654
• mRNA Refseq: NM_001037558
• Protein Refseq: NP_001032647
• MIM: 611641
• UniProt ID: Q6WQI6