Recombinant Human HELZ Protein, GST-tagged

• Cat.No.: HELZ-4685H
• Product Overview: Human HELZ partial ORF ( NP_055692, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HELZ is a member of the superfamily I class of RNA helicases. RNA helicases alter the conformation of RNA by unwinding double-stranded regions, thereby altering the biologic activity of the RNA molecule and regulating access to other proteins (Wagner et al., 1999 [PubMed 10471385]).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HELZ helicase with zinc finger [ Homo sapiens ]
• Official Symbol: HELZ
• Synonyms: HELZ; helicase with zinc finger; probable helicase with zinc finger domain; DHRC; down regulated in human cancers; HUMORF5; KIAA0054; helicase with zinc finger domain; down-regulated in human cancers protein; DRHC; MGC163454; DKFZp586G1924
• Gene ID: 9931
• mRNA Refseq: NM_014877
• Protein Refseq: NP_055692
• MIM: 606699
• UniProt ID: P42694