Recombinant Human HECTD4 Protein, GST-tagged

• Cat.No.: HECTD4-511H
• Product Overview: Human C12orf51 partial ORF ( XP_497354, 3105 a.a. - 3209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.29 kDa
• AA Sequence: DQHIEFFWGALEMFTQEELCKFIKFACNQERIPFTCPCKDGGPDTAHVPPYPMKIAPPDGTAGSPDSRYIRVETCMFMIKLPQYSSLEIMLEKLRCAIHYREDPL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HECTD4 HECT domain containing E3 ubiquitin protein ligase 4 [ Homo sapiens (human) ]
• Official Symbol: HECTD4
• Synonyms: probable E3 ubiquitin-protein ligase HECTD4; transmembrane protein C12orf51; HECT domain-containing protein 4; AF-1 specific protein phosphatase; probable E3 ubiquitin-protein ligase C12orf51; C12orf51; DKFZp586O1022; FLJ10510; FLJ30092; FLJ30208; FLJ34154; KIAA0614; MGC126531
• Gene ID: 283450
• mRNA Refseq: NM_001109662.3
• Protein Refseq: NP_001103132.3
• UniProt ID: Q9Y4D8