Recombinant Human HECTD2 protein, His-tagged
| Cat.No. : | HECTD2-21H |
| Product Overview : | Recombinant Human HECTD2 protein(Pro21-Lys170)(Q5U5R9) was expressed in E. coli with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His |
| Protein length : | 21-170 a.a. |
| Form : | Phosphate buffered saline |
| AASequence : | PEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKKEAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFK |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ] |
| Official Symbol | HECTD2 |
| Synonyms | HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050; |
| Gene ID | 143279 |
| mRNA Refseq | NM_173497 |
| Protein Refseq | NP_775768 |
| UniProt ID | Q5U5R9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HECTD2 Products
Required fields are marked with *
My Review for All HECTD2 Products
Required fields are marked with *
0
Inquiry Basket
