Recombinant Human HECTD2 protein, His-tagged

• Cat.No.: HECTD2-20H
• Product Overview: Recombinant Human HECTD2 protein(428-776 aa) was expressed in E. coli with a polyhistidine tag at the N-terminus.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 428-776 a.a.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: SDSLDELTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKDSHCHWFSSFKCDNYSEFRLVGILMGLAVYNSITFDIRFPPCCYKKLLSPPIIPSGQNIPVGICNVTVDDLCQIMPELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKISVTNQNRKEYVQLYTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNETSTNCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEGFGLE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ]
• Official Symbol: HECTD2
• Synonyms: HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050
• Gene ID: 143279
• mRNA Refseq: NM_173497
• Protein Refseq: NP_775768
• UniProt ID: Q5U5R9