Recombinant Human HECTD2 Protein, GST-tagged

• Cat.No.: HECTD2-4677H
• Product Overview: Human HECTD2 full-length ORF ( NP_775768.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HECTD2 (HECT Domain E3 Ubiquitin Protein Ligase 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity. An important paralog of this gene is UBE3A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 48.7 kDa
• AA Sequence: MSEAVRVPSPATPLVVAAAAPEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKKEAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFKKDATASFNTIEDSGINAKFVNAVYDTLLNTVSIMTCK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ]
• Official Symbol: HECTD2
• Synonyms: HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050
• Gene ID: 143279
• mRNA Refseq: NM_173497
• Protein Refseq: NP_775768
• UniProt ID: Q5U5R9