Recombinant Human HECTD1 Protein, GST-tagged

• Cat.No.: HECTD1-4676H
• Product Overview: Human HECTD1 partial ORF ( NP_056197, 3 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HECTD1 (HECT Domain E3 Ubiquitin Protein Ligase 1) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include binding and ubiquitin-protein transferase activity. An important paralog of this gene is TRIP12.
• Molecular Mass: 37.62 kDa
• AA Sequence: DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HECTD1 HECT domain containing E3 ubiquitin protein ligase 1 [ Homo sapiens ]
• Official Symbol: HECTD1
• Synonyms: HECTD1; HECT domain containing E3 ubiquitin protein ligase 1; HECT domain containing 1; E3 ubiquitin-protein ligase HECTD1; KIAA1131; EULIR; E3 ligase for inhibin receptor; HECT domain-containing protein 1; FLJ38315
• Gene ID: 25831
• mRNA Refseq: NM_015382
• Protein Refseq: NP_056197
• UniProt ID: Q9ULT8