Recombinant Human HECA Protein, GST-tagged

• Cat.No.: HECA-4675H
• Product Overview: Human HECA partial ORF ( NP_057301, 434 a.a. - 543 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits terminal branching of neighboring cells during tracheal development. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HECA headcase homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: HECA
• Synonyms: HECA; headcase homolog (Drosophila); headcase protein homolog; dJ225E12.1; HDC; HDCL; hHDC; HHDC
• Gene ID: 51696
• mRNA Refseq: NM_016217
• Protein Refseq: NP_057301
• MIM: 607977
• UniProt ID: Q9UBI9