Recombinant Human HEBP1 Protein, GST-tagged

• Cat.No.: HEBP1-4671H
• Product Overview: Human HEBP1 full-length ORF ( AAH16277.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq
• Molecular Mass: 47.5 kDa
• AA Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HEBP1 heme binding protein 1 [ Homo sapiens ]
• Official Symbol: HEBP1
• Synonyms: HEBP1; heme binding protein 1; heme-binding protein 1; HBP; HEBP; p22HBP
• Gene ID: 50865
• mRNA Refseq: NM_015987
• Protein Refseq: NP_057071
• MIM: 605826
• UniProt ID: Q9NRV9