Recombinant Human HEBP1 Protein, GST-tagged
Cat.No. : | HEBP1-4671H |
Product Overview : | Human HEBP1 full-length ORF ( AAH16277.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq |
Molecular Mass : | 47.5 kDa |
AA Sequence : | MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HEBP1 heme binding protein 1 [ Homo sapiens ] |
Official Symbol | HEBP1 |
Synonyms | HEBP1; heme binding protein 1; heme-binding protein 1; HBP; HEBP; p22HBP; |
Gene ID | 50865 |
mRNA Refseq | NM_015987 |
Protein Refseq | NP_057071 |
MIM | 605826 |
UniProt ID | Q9NRV9 |
◆ Recombinant Proteins | ||
HEBP1-3455HF | Recombinant Full Length Human HEBP1 Protein, GST-tagged | +Inquiry |
HEBP1-1096H | Recombinant Human HEBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hebp1-1108M | Recombinant Mouse Hebp1 Protein, MYC/DDK-tagged | +Inquiry |
HEBP1-4111M | Recombinant Mouse HEBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hebp1-1458M | Recombinant Mouse Hebp1 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEBP1-5593HCL | Recombinant Human HEBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HEBP1 Products
Required fields are marked with *
My Review for All HEBP1 Products
Required fields are marked with *
0
Inquiry Basket