Recombinant Human HDHD1, His-tagged

• Cat.No.: HDHD1-29208TH
• Product Overview: Recombinant full length Human HDHD1A with N terminal His tag; 248 amino acids with tag, predicted MWt 27.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 228 amino acids
• Description: This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
• Conjugation: HIS
• Molecular Weight: 27.400kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
• Sequence Similarities: Belongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family.

Gene Information

• Gene Name: HDHD1 haloacid dehalogenase-like hydrolase domain containing 1 [ Homo sapiens ]
• Official Symbol: HDHD1
• Synonyms: HDHD1; haloacid dehalogenase-like hydrolase domain containing 1; FAM16AX, family with sequence similarity 16, member A, X linked , haloacid dehalogenase like hydrolase domain containing 1A , HDHD1A; pseudouridine-5-monophosphatase; DXF68S1E; GS1
• Gene ID: 8226
• mRNA Refseq: NM_001178135
• Protein Refseq: NP_001171606
• MIM: 306480
• Uniprot ID: Q08623
• Chromosome Location: Xp22.32
• Function: hydrolase activity; metal ion binding; molecular_function; phosphatase activity