Recombinant Human HDC protein(291-360 aa), C-His-tagged

• Cat.No.: HDC-2680H
• Product Overview: Recombinant Human HDC protein(P19113)(291-360 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 291-360 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: HDC histidine decarboxylase [ Homo sapiens ]
• Official Symbol: HDC
• Synonyms: HDC; histidine decarboxylase; MGC163399
• Gene ID: 3067
• mRNA Refseq: NM_002112
• Protein Refseq: NP_002103
• MIM: 142704
• UniProt ID: P19113