Recombinant Human HDAC6 Protein, GST-tagged

Cat.No. : HDAC6-4648H
Product Overview : Human HDAC6 partial ORF ( NP_006035, 1128 a.a. - 1215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq
Molecular Mass : 35.42 kDa
AA Sequence : DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HDAC6 histone deacetylase 6 [ Homo sapiens ]
Official Symbol HDAC6
Synonyms HDAC6; histone deacetylase 6; FLJ16239; HD6; JM21; KIAA0901;
Gene ID 10013
mRNA Refseq NM_006044
Protein Refseq NP_006035
MIM 300272
UniProt ID Q9UBN7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HDAC6 Products

Required fields are marked with *

My Review for All HDAC6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon