Recombinant Human HCRTR2 Protein, GST-tagged

• Cat.No.: HCRTR2-4636H
• Product Overview: Human HCRTR2 partial ORF ( NP_001517, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A. [provided by RefSeq
• Molecular Mass: 31.68 kDa
• AA Sequence: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HCRTR2 hypocretin (orexin) receptor 2 [ Homo sapiens ]
• Official Symbol: HCRTR2
• Synonyms: HCRTR2; hypocretin (orexin) receptor 2; orexin receptor type 2; OX2R; ox2-R; ox-2-R; hypocretin receptor type 2
• Gene ID: 3062
• mRNA Refseq: NM_001526
• Protein Refseq: NP_001517
• MIM: 602393
• UniProt ID: O43614