Recombinant Human HCP5 Protein, GST-tagged

• Cat.No.: HCP5-4632H
• Product Overview: Human HCP5 partial ORF ( NP_006665, 3 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HCP5 (HLA Complex P5 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. Diseases associated with HCP5 include Herpes Zoster.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.85 kDa
• AA Sequence: LRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HCP5 HLA complex P5 [ Homo sapiens ]
• Official Symbol: HCP5
• Synonyms: HCP5; HLA complex P5; D6S2650E; P5 1; P5-1
• Gene ID: 10866
• MIM: 604676
• UniProt ID: Q6MZN7