Recombinant Human HCFC1R1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HCFC1R1-1863H
• Product Overview: HCFC1R1 MS Standard C13 and N15-labeled recombinant protein (NP_060355) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 15.3 kDa
• AA Sequence: MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HCFC1R1 host cell factor C1 regulator 1 [ Homo sapiens (human) ]
• Official Symbol: HCFC1R1
• Synonyms: HCFC1R1; host cell factor C1 regulator 1 (XPO1 dependent); host cell factor C1 regulator 1 (XPO1 dependant); host cell factor C1 regulator 1; FLJ20568; HPIP; HCF-1 beta-propeller interacting protein; HCF-1 beta-propeller-interacting protein; MGC70711; MGC99622
• Gene ID: 54985
• mRNA Refseq: NM_017885
• Protein Refseq: NP_060355
• MIM: 618818
• UniProt ID: Q9NWW0