Recombinant Human HCFC1R1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HCFC1R1-1863H
Product Overview : HCFC1R1 MS Standard C13 and N15-labeled recombinant protein (NP_060355) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.
Molecular Mass : 15.3 kDa
AA Sequence : MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HCFC1R1 host cell factor C1 regulator 1 [ Homo sapiens (human) ]
Official Symbol HCFC1R1
Synonyms HCFC1R1; host cell factor C1 regulator 1 (XPO1 dependent); host cell factor C1 regulator 1 (XPO1 dependant); host cell factor C1 regulator 1; FLJ20568; HPIP; HCF-1 beta-propeller interacting protein; HCF-1 beta-propeller-interacting protein; MGC70711; MGC99622;
Gene ID 54985
mRNA Refseq NM_017885
Protein Refseq NP_060355
MIM 618818
UniProt ID Q9NWW0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HCFC1R1 Products

Required fields are marked with *

My Review for All HCFC1R1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon