Recombinant Human HCFC1

• Cat.No.: HCFC1-29188TH
• Product Overview: Recombinant fragment of Human Host Cell Factor C1 with N-terminal proprietary tag. Predicted MW 35.20 kDa.

Specification

• Description: This gene is a member of the host cell factor family and encodes a protein with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
• Protein length: 87 amino acids
• Molecular Weight: 35.200kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in fetal tissues and the adult kidney. Present in all tissues tested.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTIL
• Sequence Similarities: Contains 5 Kelch repeats.
• Tag: Non

Gene Information

• Gene Name: HCFC1 host cell factor C1 (VP16-accessory protein) [ Homo sapiens ]
• Official Symbol: HCFC1
• Synonyms: HCFC1; host cell factor C1 (VP16-accessory protein); HFC1; host cell factor 1; CFF; HCF 1; HCF1; MGC70925; VCAF
• Gene ID: 3054
• mRNA Refseq: NM_005334
• Protein Refseq: NP_005325
• MIM: 300019
• Uniprot ID: P51610
• Chromosome Location: Xq28
• Pathway: Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem
• Function: chromatin binding; identical protein binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity