Recombinant Human HBM Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HBM-5219H
• Product Overview: HBM MS Standard C13 and N15-labeled recombinant protein (NP_001003938) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. This gene has an ORF encoding a 141 aa polypeptide which is similar to the delta globins found in reptiles and birds. This locus was originally described as a pseudogene; however, it is currently thought to be a protein-coding gene.
• Molecular Mass: 15.6 kDa
• AA Sequence: MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKYRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HBM hemoglobin subunit mu [ Homo sapiens (human) ]
• Official Symbol: HBM
• Synonyms: hemoglobin, mu; 4826; Ensembl:ENSG00000206177; hemoglobin subunit mu;mu-globin;hemoglobin mu chain;alpha globin pseudogene 2;hemoglobin, alpha pseudogene 2; HBAP2
• Gene ID: 3042
• mRNA Refseq: NM_001003938
• Protein Refseq: NP_001003938
• MIM: 609639
• UniProt ID: Q6B0K9