Recombinant Human HBEGF Protein (63-148 aa), His-tagged
Cat.No. : | HBEGF-2526H |
Product Overview : | Recombinant Human HBEGF Protein (63-148 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 63-148 aa |
Description : | Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.7 kDa |
AA Sequence : | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ] |
Official Symbol | HBEGF |
Synonyms | HBEGF; heparin-binding EGF-like growth factor; DTR; DTS; DTSF; HEGFL; |
Gene ID | 1839 |
mRNA Refseq | NM_001945 |
Protein Refseq | NP_001936 |
MIM | 126150 |
UniProt ID | Q99075 |
◆ Recombinant Proteins | ||
Hbegf-564M | Recombinant Mouse Hbegf protein | +Inquiry |
HBEGF-6412C | Recombinant Chicken HBEGF | +Inquiry |
HBEGF-7506M | Recombinant Mouse HBEGF Protein | +Inquiry |
HBEGF-2455R | Recombinant Rat HBEGF Protein, His (Fc)-Avi-tagged | +Inquiry |
HBEGF-2526H | Recombinant Human HBEGF Protein (63-148 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBEGF Products
Required fields are marked with *
My Review for All HBEGF Products
Required fields are marked with *
0
Inquiry Basket