Recombinant Human HBEGF protein

• Cat.No.: HBEGF-530H
• Product Overview: Recombinant Human HBEGF protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 86
• Description: Heparin-binding epidermal growth factor (HB-EGF)-like growth factor (EGF) is found in cerebral neurons. Its expression is increased after hypoxic or ischemic injury, which also stimulates neurogenesis. HB-EGF has been implicated as a participant in a variety of normal physiological processes such as blastocyst implantation, wound healing, and in pathological processes such as tumor growth, SMC hyperplasia and atherosclerosis. HB-EGF is an 87 amino acid mitogenic and chemotactic glycoprotein containing an EGF-like domain with six conserved cysteine residues. Human HB-EGF shares about 73 % and 76 % a.a. sequence identity with murine and rat HB-EGF.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 9.7 kDa, a single non-glycosylated polypeptide chain containing 86 amino acids.
• AA Sequence: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
• Endotoxin: Less than 1 EU/μg of rHuHB-EGF as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: HBEGF
• Official Symbol: HBEGF
• Synonyms: HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL
• Gene ID: 1839
• mRNA Refseq: NM_001945
• Protein Refseq: NP_001936
• MIM: 126150
• UniProt ID: Q99075