Recombinant Human HAVCR2 Protein, GST-tagged

Cat.No. : HAVCR2-4591H
Product Overview : Human HAVCR2 full-length ORF ( AAH20843, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM
Molecular Mass : 41.36 kDa
AA Sequence : MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ]
Official Symbol HAVCR2
Synonyms HAVCR2; hepatitis A virus cellular receptor 2; FLJ14428; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; T cell immunoglobulin mucin-3; T-cell immunoglobulin and mucin domain-containing protein 3; KIM-3; Tim-3; TIMD-3; HAVcr-2;
Gene ID 84868
mRNA Refseq NM_032782
Protein Refseq NP_116171
MIM 606652
UniProt ID Q8TDQ0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HAVCR2 Products

Required fields are marked with *

My Review for All HAVCR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon