Recombinant Human HAVCR2 Protein, GST-tagged

• Cat.No.: HAVCR2-4591H
• Product Overview: Human HAVCR2 full-length ORF ( AAH20843, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 41.36 kDa
• AA Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ]
• Official Symbol: HAVCR2
• Synonyms: HAVCR2; hepatitis A virus cellular receptor 2; FLJ14428; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; T cell immunoglobulin mucin-3; T-cell immunoglobulin and mucin domain-containing protein 3; KIM-3; Tim-3; TIMD-3; HAVcr-2
• Gene ID: 84868
• mRNA Refseq: NM_032782
• Protein Refseq: NP_116171
• MIM: 606652
• UniProt ID: Q8TDQ0