Recombinant Human HAPLN2 Protein, GST-tagged

• Cat.No.: HAPLN2-4575H
• Product Overview: Human HAPLN2 full-length ORF (BAG52217.1, 1 a.a. - 340 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: HAPLN2 (Hyaluronan And Proteoglycan Link Protein 2) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN3.
• Source: wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.2 kDa
• AA Sequence: MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAPLN2 hyaluronan and proteoglycan link protein 2 [ Homo sapiens ]
• Official Symbol: HAPLN2
• Synonyms: BRAL1
• Gene ID: 60484
• mRNA Refseq: NM_021817
• Protein Refseq: NP_068589
• UniProt ID: Q9GZV7