Recombinant Human HAMP protein, GST-tagged

Cat.No. : HAMP-280H
Product Overview : Recombinant Human HAMP fused with GST tag at N-terminal was expressed in E. coli.
Availability March 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure.
Form : Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol
Molecular Mass : 2.92kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYI ADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRG SENLYFQGHMDTHFPICIFCCGCCHRSKCG
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Publications :
Hepcidin Upregulation in Colorectal Cancer Associates with Accumulation of Regulatory Macrophages and Epithelial–Mesenchymal Transition and Correlates with Progression of the Disease (2021)
Gene Name HAMP hepcidin antimicrobial peptide [ Homo sapiens ]
Official Symbol HAMP
Synonyms HAMP; hepcidin antimicrobial peptide; hepcidin; HEPC; HFE2B; LEAP 1; LEAP1; putative liver tumor regressor; liver-expressed antimicrobial peptide 1; PLTR;
Gene ID 57817
mRNA Refseq NM_021175
Protein Refseq NP_066998
MIM 606464
UniProt ID P81172
Chromosome Location 19q13.1
Function hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HAMP Products

Required fields are marked with *

My Review for All HAMP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon