Recombinant Human HAMP protein, GST-tagged
Cat.No. : | HAMP-280H |
Product Overview : | Recombinant Human HAMP fused with GST tag at N-terminal was expressed in E. coli. |
Availability | March 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. |
Form : | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol |
Molecular Mass : | 2.92kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYI ADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRG SENLYFQGHMDTHFPICIFCCGCCHRSKCG |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Publications : |
Hepcidin Upregulation in Colorectal Cancer Associates with Accumulation of Regulatory Macrophages and Epithelial–Mesenchymal Transition and Correlates with Progression of the Disease (2021)
|
Gene Name | HAMP hepcidin antimicrobial peptide [ Homo sapiens ] |
Official Symbol | HAMP |
Synonyms | HAMP; hepcidin antimicrobial peptide; hepcidin; HEPC; HFE2B; LEAP 1; LEAP1; putative liver tumor regressor; liver-expressed antimicrobial peptide 1; PLTR; |
Gene ID | 57817 |
mRNA Refseq | NM_021175 |
Protein Refseq | NP_066998 |
MIM | 606464 |
UniProt ID | P81172 |
Chromosome Location | 19q13.1 |
Function | hormone activity; |
◆ Recombinant Proteins | ||
Hamp-3354M | Recombinant Mouse Hamp Protein, Myc/DDK-tagged | +Inquiry |
HAMP-2056C | Recombinant Cattle HAMP protein, His & GST-tagged | +Inquiry |
Hamp-2060R | Recombinant Rat Hamp protein, His & GST-tagged | +Inquiry |
HAMP-9191HFL | Recombinant Full Length Human HAMP, Flag-tagged | +Inquiry |
HAMP-4564H | Recombinant Human HAMP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAMP-5640HCL | Recombinant Human HAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAMP Products
Required fields are marked with *
My Review for All HAMP Products
Required fields are marked with *
0
Inquiry Basket