Recombinant Human HACE1 Protein, GST-tagged

• Cat.No.: HACE1-4552H
• Product Overview: Human HACE1 partial ORF ( NP_065822, 800 a.a. - 909 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a HECT domain and ankyrin repeat-containing ubiquitin ligase. The encoded protein is involved in specific tagging of target proteins, leading to their subcellular localization or proteasomal degradation. The protein is a potential tumor suppressor and is involved in the pathophysiology of several tumors, including Wilm's tumor. [provided by RefSeq, Mar 2016]
• Molecular Mass: 37.84 kDa
• AA Sequence: TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HACE1 HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 [ Homo sapiens ]
• Official Symbol: HACE1
• Synonyms: HACE1; HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1; E3 ubiquitin-protein ligase HACE1; KIAA1320; HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1; HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
• Gene ID: 57531
• mRNA Refseq: NM_020771
• Protein Refseq: NP_065822
• MIM: 610876
• UniProt ID: Q8IYU2