Recombinant Human H3F3A protein, T7/His-tagged

• Cat.No.: H3F3A-62H
• Product Overview: Recombinant human Histone 3.3 (H2F3A) cDNA (136aa, which derived from BC066901) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTV ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMP KDIQLARRIRGERA
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro Histone 3.3 mediated HIRA-dependent H3.3 deposition in cell reprogramming regulation study with "ProFectin" based intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for H3.3 protein-protein interaction mapping.4. May be used as antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: H3F3A H3 histone, family 3A [ Homo sapiens ]
• Official Symbol: H3F3A
• Synonyms: H3F3A; H3 histone, family 3A; H3F3; histone H3.3; H3.3A; H3F3B; MGC87782; MGC87783
• Gene ID: 3020
• mRNA Refseq: NM_002107
• Protein Refseq: NP_002098
• MIM: 601128
• UniProt ID: P84243
• Chromosome Location: 1q42.12
• Pathway: Alcoholism, organism-specific biosystem; Alcoholism, conserved biosystem; Amyloids, organism-specific biosystem; Disease, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Gene Expression, organism-specific biosystem; Hemostasis, organism-specific biosystem