Recombinant Human H2BC4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: H2BC4-4244H
• Product Overview: HIST1H2BC MS Standard C13 and N15-labeled recombinant protein (NP_003517) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. The protein has antibacterial and antifungal antimicrobial activity. The main transcript variant of this gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. This transcript variant lacks a polyA tail but instead contains a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
• Molecular Mass: 13.7 kDa
• AA Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: H2BC4 H2B clustered histone 4 [ Homo sapiens (human) ]
• Official Symbol: H2BC4
• Synonyms: H2BC4; H2B clustered histone 4; H2B.1; H2B/l; H2BC6; H2BC7; H2BC8; H2BFL; H2BC10; HIST1H2BC; dJ221C16.3; histone H2B type 1-C/E/F/G/I; H2B histone family, member L; histone 1, H2bc; histone H2B.1 A; histone H2B.l; histone cluster 1 H2B family member c; histone cluster 1, H2bc
• Gene ID: 8347
• mRNA Refseq: NM_003526
• Protein Refseq: NP_003517
• MIM: 602847
• UniProt ID: P62807