Recombinant Human H2AFZ protein, GST-tagged

• Cat.No.: H2AFZ-3012H
• Product Overview: Recombinant Human H2AFZ protein(P0C0S5)(1-128aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.4 kDa
• Protein length: 1-128aa
• AA Sequence: AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: H2AFZ H2A histone family, member Z [ Homo sapiens ]
• Official Symbol: H2AFZ
• Synonyms: H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z; H2AZ histone; H2A.z; H2A/z; MGC117173
• Gene ID: 3015
• mRNA Refseq: NM_002106
• Protein Refseq: NP_002097
• MIM: 142763
• UniProt ID: P0C0S5