Recombinant Human GZMB protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	31.0 kDa
Protein length :	21-247aa
AA Sequence :	IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Name	GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) [ Homo sapiens ]
Official Symbol	GZMB
Synonyms	GZMB; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); CSPB, CTLA1; granzyme B; cathepsin G like 1; CCPI; CGL 1; CGL1; CSP B; CTSGL1; cytotoxic serine protease B; fragmentin 2; HLP; SECT; T cell serine protease 1 3E; C11; CTLA-1; fragmentin-2; cathepsin G-like 1; human lymphocyte protein; T-cell serine protease 1-3E; cytotoxic T-lymphocyte proteinase 2; CSPB; CGL-1; CSP-B; CTLA1;
Gene ID	3002
mRNA Refseq	NM_004131
Protein Refseq	NP_004122
MIM	123910
UniProt ID	P10144