Recombinant Human GZMA

• Cat.No.: GZMA-26406TH
• Product Overview: Recombinant fragment of Human Granzyme A (aa 41-141) with N-terminal proprietary tag, 36.74 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 101 amino acids
• Description: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.
• Molecular Weight: 36.740kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVIL GAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL TEKAKINKYVTILHLPKKGDD
• Sequence Similarities: Belongs to the peptidase S1 family. Granzyme subfamily.Contains 1 peptidase S1 domain.

Gene Information

• Gene Name: GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ]
• Official Symbol: GZMA
• Synonyms: GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease)
• Gene ID: 3001
• mRNA Refseq: NM_006144
• Protein Refseq: NP_006135
• MIM: 140050
• Uniprot ID: P12544
• Chromosome Location: 5q11-q12
• Pathway: IL12-mediated signaling events, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem
• Function: peptidase activity; protein binding; protein homodimerization activity; serine-type endopeptidase activity