Recombinant Human GYS1, GST-tagged
Cat.No. : | GYS1-13H |
Product Overview : | Recombinant Human GYS1(1 a.a. - 737 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 110.2 kDa |
AA Sequence : | MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRT QVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREAND AVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLE NFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNF NVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLD DSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIP SISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERY DEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GYS1 glycogen synthase 1 (muscle) [ Homo sapiens (human) ] |
Official Symbol | GYS1 |
Synonyms | GYS1; GSY; GYS; glycogen synthase 1 (muscle); glycogen [starch] synthase, muscle; NP_001155059.1; EC 2.4.1.11; NP_002094.2 |
Gene ID | 2997 |
mRNA Refseq | NM_002103 |
Protein Refseq | NP_002094 |
MIM | 138570 |
UniProt ID | P13807 |
Chromosome Location | 19q13.3 |
Pathway | Glucose metabolism; Insulin Signaling; Metabolism of carbohydrates |
Function | glucose binding; glycogen (starch) synthase activity; glycogen synthase activity, transferring glucose-1-phosphate |
◆ Recombinant Proteins | ||
RLN2-3721R | Recombinant Rhesus Macaque RLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
YPZK-2526B | Recombinant Bacillus subtilis YPZK protein, His-tagged | +Inquiry |
UQCR11-4106C | Recombinant Chicken UQCR11 | +Inquiry |
NTN1-66C | Active Recombinant Chicken NTN1 Protein, His-tagged | +Inquiry |
PRDX5-3781H | Recombinant Human PRDX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
Plg-5465R | Native Rat Plasminogen | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPA1-2478MCL | Recombinant Mouse CPA1 cell lysate | +Inquiry |
ARHGEF2-8732HCL | Recombinant Human ARHGEF2 293 Cell Lysate | +Inquiry |
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
ZNF385C-83HCL | Recombinant Human ZNF385C 293 Cell Lysate | +Inquiry |
PPIL1-2968HCL | Recombinant Human PPIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GYS1 Products
Required fields are marked with *
My Review for All GYS1 Products
Required fields are marked with *
0
Inquiry Basket