Recombinant Human GYPA protein, His-tagged

Cat.No. : GYPA-3008H
Product Overview : Recombinant Human GYPA protein(A0A0C4DFT7)(20-91aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 20-91aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 12 kDa
AA Sequence : LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GYPA glycophorin A (MNS blood group) [ Homo sapiens ]
Official Symbol GYPA
Synonyms GYPA; glycophorin A (MNS blood group); glycophorin A (includes MN blood group) , glycophorin A (MN blood group) , MNS; glycophorin-A; CD235a; GPA; MN; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Erik; glycophorin A, GPA; MN sialoglycoprotein; glycophorin Sta type C; sialoglycoprotein alpha; Mi.V glycoprotein (24 AA); glycophorin A (MN blood group); recombinant glycophorin A-B Miltenberger-DR; erythroid-lineage-specific membrane sialoglycoprotein; MNS; GPSAT; PAS-2; GPErik; HGpMiV; HGpMiXI; HGpSta(C);
Gene ID 2993
mRNA Refseq NM_002099
Protein Refseq NP_002090
UniProt ID P02724

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GYPA Products

Required fields are marked with *

My Review for All GYPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon