Recombinant Human GYG1 Protein, GST-tagged

• Cat.No.: GYG1-4502H
• Product Overview: Human GYG partial ORF ( NP_004121, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the glycogenin family. Glycogenin is a glycosyltransferase that catalyzes the formation of a short glucose polymer from uridine diphosphate glucose in an autoglucosylation reaction. This reaction is followed by elongation and branching of the polymer, catalyzed by glycogen synthase and branching enzyme, to form glycogen. This gene is expressed in muscle and other tissues. Mutations in this gene result in glycogen storage disease XV. This gene has pseudogenes on chromosomes 1, 8 and 13 respectively. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]
• Molecular Mass: 33.77 kDa
• AA Sequence: MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GYG1 glycogenin 1 [ Homo sapiens ]
• Official Symbol: GYG1
• Synonyms: GYG1; glycogenin 1; glycogenin , GYG; glycogenin-1; GN-1; GYG; GSD15
• Gene ID: 2992
• mRNA Refseq: NM_001184720
• Protein Refseq: NP_001171649
• MIM: 603942
• UniProt ID: P46976