Recombinant Human GUCY2D Protein, GST-tagged

• Cat.No.: GUCY2D-4493H
• Product Overview: Human GUCY2D partial ORF ( NP_000171, 521 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq
• Molecular Mass: 37.73 kDa
• AA Sequence: RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCY2D guanylate cyclase 2D, membrane (retina-specific) [ Homo sapiens ]
• Official Symbol: GUCY2D
• Synonyms: GUCY2D; guanylate cyclase 2D, membrane (retina-specific); cone rod dystrophy 5/6 , CORD5, CORD6, GUC1A4, GUC2D, LCA; retinal guanylyl cyclase 1; CYGD; LCA1; retGC; RETGC 1; ROS GC1; ROS-GC; guanylate cyclase 2D, retinal; rod outer segment membrane guanylate cyclase; LCA; RCD2; CORD5; CORD6; GUC2D; ROSGC; GUC1A4; RETGC-1; ROS-GC1
• Gene ID: 3000
• mRNA Refseq: NM_000180
• Protein Refseq: NP_000171
• MIM: 600179
• UniProt ID: Q02846