Recombinant Human GTSF1L Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GTSF1L-983H
• Product Overview: GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: GTSF1L (Gametocyte Specific Factor 1 Like) is a Protein Coding gene. An important paralog of this gene is GTSF1.
• Molecular Mass: 14 kDa
• AA Sequence: MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQTFFPQKVVCENDTKESARETSPQKILRPGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GTSF1L gametocyte specific factor 1-like [ Homo sapiens (human) ]
• Official Symbol: GTSF1L
• Synonyms: gametocyte specific factor 1-like; 16198; Ensembl:ENSG00000124196; MGC50820; gametocyte-specific factor 1-like;family with sequence similarity 112, member A; FAM112A; C20orf65; dJ1028D15.4
• Gene ID: 149699
• mRNA Refseq: NM_001008901
• Protein Refseq: NP_001008901
• UniProt ID: Q5JWH5