Recombinant Human GTPBP2 Protein, GST-tagged

Cat.No. : GTPBP2-4471H
Product Overview : Human GTPBP2 partial ORF ( NP_061969, 67 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.[supplied by OMIM
Molecular Mass : 37.4 kDa
AA Sequence : NIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTPBP2 GTP binding protein 2 [ Homo sapiens ]
Official Symbol GTPBP2
Synonyms GTPBP2; GTP binding protein 2; GTP-binding protein 2; MGC74725;
Gene ID 54676
mRNA Refseq NM_019096
Protein Refseq NP_061969
MIM 607434
UniProt ID Q9BX10

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GTPBP2 Products

Required fields are marked with *

My Review for All GTPBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon