Recombinant Human GTF3C4, GST-tagged

• Cat.No.: GTF3C4-120H
• Product Overview: Recombinant Human GTF3C4(723 a.a. - 822 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: General transcription factor 3C polypeptide 4 is a protein that in humans is encoded by the GTF3C4 gene.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARH PAPEDPDWIKRLLQSPCPFCDSPVF
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTF3C4 general transcription factor IIIC, polypeptide 4, 90kDa [ Homo sapiens (human) ]
• Official Symbol: GTF3C4
• Synonyms: GTF3C4; KAT12; TFIII90; TFIIIC90; TFIIIC290; TFIIICDELTA; general transcription factor IIIC, polypeptide 4, 90kDa; general transcription factor 3C polypeptide 4; TF3C-delta; TFIIIC 90 kDa subunit; general transcription factor 3C 4; transcription factor IIIC subunit delta; transcription factor IIIC 90 kDa subunit; NP_036336.2; EC 2.3.1.48
• Gene ID: 9329
• mRNA Refseq: NM_012204
• Protein Refseq: NP_036336
• MIM: 604892
• UniProt ID: Q9UKN8
• Chromosome Location: 9q34.13
• Pathway: RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription; RNA Polymerase III Abortive And Retractive Initiation; RNA Polymerase III Transcription Initiation
• Function: contributes_to DNA binding; enzyme activator activity; histone acetyltransferase activity