Recombinant Human GTF3A Protein, GST-tagged

• Cat.No.: GTF3A-4461H
• Product Overview: Human GTF3A partial ORF ( NP_002088, 185 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein. [provided by RefSeq
• Molecular Mass: 35.64 kDa
• AA Sequence: NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTF3A general transcription factor IIIA [ Homo sapiens ]
• Official Symbol: GTF3A
• Synonyms: GTF3A; general transcription factor IIIA; transcription factor IIIA; AP2; TFIIIA
• Gene ID: 2971
• mRNA Refseq: NM_002097
• Protein Refseq: NP_002088
• MIM: 600860
• UniProt ID: Q92664