Recombinant Human GTF2H3 Protein, GST-tagged

• Cat.No.: GTF2H3-4450H
• Product Overview: Human GTF2H3 full-length ORF ( NP_001507.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14. [provided by RefSeq, Dec 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 60.8 kDa
• AA Sequence: MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTF2H3 general transcription factor IIH, polypeptide 3, 34kDa [ Homo sapiens ]
• Official Symbol: GTF2H3
• Synonyms: GTF2H3; general transcription factor IIH, polypeptide 3, 34kDa; general transcription factor IIH, polypeptide 3 (34kD subunit); general transcription factor IIH subunit 3; BTF2; TFIIH; BTF2 p34; basic transcription factor 2 34 kDa subunit; general transcription factor IIH polypeptide 3; TFIIH basal transcription factor complex p34 subunit; TFB4
• Gene ID: 2967
• mRNA Refseq: NM_001516
• Protein Refseq: NP_001507
• MIM: 601750
• UniProt ID: Q13889