Recombinant Human GTF2A2 protein, GST-tagged

• Cat.No.: GTF2A2-3004H
• Product Overview: Recombinant Human GTF2A2 protein(P52657)(1-109aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-109aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.5 kDa
• AA Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GTF2A2 general transcription factor IIA, 2, 12kDa [ Homo sapiens ]
• Official Symbol: GTF2A2
• Synonyms: GTF2A2; general transcription factor IIA, 2, 12kDa; general transcription factor IIA, 2 (12kD subunit); transcription initiation factor IIA subunit 2; HsT18745; TFIIA; TFIIAS; TFIIA-12; TFIIA-gamma; TFIIA p12 subunit; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain; TF2A2
• Gene ID: 2958
• mRNA Refseq: NM_004492
• Protein Refseq: NP_004483
• MIM: 600519
• UniProt ID: P52657