Recombinant Human GTF2A1 Protein, GST-tagged

• Cat.No.: GTF2A1-4437H
• Product Overview: Human GTF2A1 full-length ORF ( NP_056943.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010]
• Molecular Mass: 67.9 kDa
• AA Sequence: MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTF2A1 general transcription factor IIA, 1, 19/37kDa [ Homo sapiens ]
• Official Symbol: GTF2A1
• Synonyms: GTF2A1; general transcription factor IIA, 1, 19/37kDa; glucose regulated protein, 58kD pseudogene; transcription initiation factor IIA subunit 1; TFIIA; TFIIAL; TFIIA-42; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; transcription initiation factor TFIIA 42 kDa subunit; TF2A1; MGC129969; MGC129970
• Gene ID: 2957
• mRNA Refseq: NM_015859
• Protein Refseq: NP_056943
• MIM: 600520
• UniProt ID: P52655