Recombinant Human GSX2 Protein, GST-tagged

• Cat.No.: GSX2-4396H
• Product Overview: Human GSH2 partial ORF ( NP_573574, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GSX2 (GS Homeobox 2) is a Protein Coding gene. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is GSX1.
• Molecular Mass: 33.44 kDa
• AA Sequence: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSX2 GS homeobox 2 [ Homo sapiens ]
• Official Symbol: GSX2
• Synonyms: GSX2; GS homeobox 2; Gsh2; homeobox protein GSH-2; GSH2
• Gene ID: 170825
• mRNA Refseq: NM_133267
• Protein Refseq: NP_573574
• UniProt ID: Q9BZM3