Recombinant Human GSTP1 Protein (2-210 aa), His-tagged

• Cat.No.: GSTP1-2550H
• Product Overview: Recombinant Human GSTP1 Protein (2-210 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Description: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.2 kDa
• Protein length: 2-210 aa
• AA Sequence: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ]
• Official Symbol: GSTP1
• Synonyms: GSTP1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; PI; DFN7; GST3; FAEES3
• Gene ID: 2950
• mRNA Refseq: NM_000852
• Protein Refseq: NP_000843
• MIM: 134660
• UniProt ID: P09211