Recombinant Human GSTM4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GSTM4-1106H
Product Overview : GSTM4 MS Standard C13 and N15-labeled recombinant protein (NP_000841) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 25.6 kDa
AA Sequence : MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GSTM4 glutathione S-transferase mu 4 [ Homo sapiens (human) ]
Official Symbol GSTM4
Synonyms GSTM4; glutathione S-transferase mu 4; glutathione S transferase M4; glutathione S-transferase Mu 4; GST-Mu2; GTS-Mu2; GST class-mu 4; glutathione S-transferase M4; glutathione S-aryltransferase M4; glutathione S-alkyltransferase M4; glutathione S-aralkyltransferase M4; S-(hydroxyalkyl)glutathione lyase M4; GTM4; GSTM4-4; MGC9247; MGC131945;
Gene ID 2948
mRNA Refseq NM_000850
Protein Refseq NP_000841
MIM 138333
UniProt ID Q03013

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSTM4 Products

Required fields are marked with *

My Review for All GSTM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon