Recombinant Human GSTA4 protein, His-SUMO-tagged

• Cat.No.: GSTA4-2998H
• Product Overview: Recombinant Human GSTA4 protein(O15217)(1-222aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-222aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.7 kDa
• AA Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ]
• Official Symbol: GSTA4
• Synonyms: GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4; GST class-alpha member 4; glutathione transferase A4-4; glutathione S-transferase A4-4; glutathione S-aryltransferase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; S-(hydroxyalkyl)glutathione lyase A4; GTA4; GSTA4-4; DKFZp686D21185
• Gene ID: 2941
• mRNA Refseq: NM_001512
• Protein Refseq: NP_001503
• MIM: 605450
• UniProt ID: O15217