Recombinant Human GSN

• Cat.No.: GSN-29012TH
• Product Overview: Recombinant fragment corresponding to amino acids 673-782 of Human Gelsolin with an N terminal proprietary tag; Predicted MWt 37.84 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
• Molecular Weight: 37.840kDa inclusive of tags
• Tissue specificity: Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVG KDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFE PPSFVGWFLGWDDDYWSVDPLDRAMAELAA
• Sequence Similarities: Belongs to the villin/gelsolin family.Contains 6 gelsolin-like repeats.

Gene Information

• Gene Name: GSN gelsolin [ Homo sapiens ]
• Official Symbol: GSN
• Synonyms: GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718
• Gene ID: 2934
• mRNA Refseq: NM_000177
• Protein Refseq: NP_000168
• MIM: 137350
• Uniprot ID: P06396
• Chromosome Location: 9q33
• Pathway: Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem
• Function: actin binding; calcium ion binding; protein binding