Recombinant Human GSN

Cat.No. : GSN-29012TH
Product Overview : Recombinant fragment corresponding to amino acids 673-782 of Human Gelsolin with an N terminal proprietary tag; Predicted MWt 37.84 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
Molecular Weight : 37.840kDa inclusive of tags
Tissue specificity : Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVG KDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFE PPSFVGWFLGWDDDYWSVDPLDRAMAELAA
Sequence Similarities : Belongs to the villin/gelsolin family.Contains 6 gelsolin-like repeats.
Gene Name GSN gelsolin [ Homo sapiens ]
Official Symbol GSN
Synonyms GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718;
Gene ID 2934
mRNA Refseq NM_000177
Protein Refseq NP_000168
MIM 137350
Uniprot ID P06396
Chromosome Location 9q33
Pathway Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem;
Function actin binding; calcium ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSN Products

Required fields are marked with *

My Review for All GSN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon