Recombinant Human GRPR

Cat.No. : GRPR-28627TH
Product Overview : Recombinant full length Human GRPR (amino acids 1-384) with N terminal proprietary tag; Predicted MWt 68.31 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 384 amino acids
Description : Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene.
Molecular Weight : 68.310kDa inclusive of tags
Tissue specificity : Highly expressed in pancreas. Also expressed in stomach, adrenal cortex and brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGIL YVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFIS SLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLK AAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPF ALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS LKSTNPSVATFSLINGNICHERYV
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name GRPR gastrin-releasing peptide receptor [ Homo sapiens ]
Official Symbol GRPR
Synonyms GRPR; gastrin-releasing peptide receptor;
Gene ID 2925
mRNA Refseq NM_005314
Protein Refseq NP_005305
MIM 305670
Uniprot ID P30550
Chromosome Location Xp22.2
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function G-protein coupled peptide receptor activity; bombesin receptor activity; neuropeptide binding; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRPR Products

Required fields are marked with *

My Review for All GRPR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon