Recombinant Human GRM3

• Cat.No.: GRM3-29609TH
• Product Overview: Recombinant fragment of Human Metabotropic Glutamate Receptor 3 with N terminal proprietary tag, 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
• Sequence Similarities: Belongs to the G-protein coupled receptor 3 family.

Gene Information

• Gene Name: GRM3 glutamate receptor, metabotropic 3 [ Homo sapiens ]
• Official Symbol: GRM3
• Synonyms: GRM3; glutamate receptor, metabotropic 3; metabotropic glutamate receptor 3; GPRC1C; mGlu3; MGLUR3
• Gene ID: 2913
• mRNA Refseq: NM_000840
• Protein Refseq: NP_000831
• MIM: 601115
• Uniprot ID: Q14832
• Chromosome Location: 7q21.1-q21.2
• Pathway: Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class C Metabotropic glutamate, pheromone, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem
• Function: G-protein coupled receptor activity; G-protein coupled receptor activity; calcium channel regulator activity; glutamate receptor activity; group II metabotropic glutamate receptor activity