Recombinant Human GRM1 protein(881-960 aa), C-His-tagged

• Cat.No.: GRM1-2851H
• Product Overview: Recombinant Human GRM1 protein(Q13255)(881-960 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 881-960 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 10.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AGAGNANSNGKSVSWSEPGGGQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE

Gene Information

• Gene Name: GRM1 glutamate receptor, metabotropic 1 [ Homo sapiens ]
• Official Symbol: GRM1
• Synonyms: GRM1; glutamate receptor, metabotropic 1; metabotropic glutamate receptor 1; GPRC1A; mGlu1; MGLUR1; GRM1A; MGLUR1A
• Gene ID: 2911
• mRNA Refseq: NM_000838
• Protein Refseq: NP_000829
• MIM: 604473
• UniProt ID: Q13255