Recombinant Human GRK1 Protein, GST-tagged

Cat.No. : GRK1-5352H
Product Overview : Human GRK1 partial ORF ( NP_002920.1, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRK1 G protein-coupled receptor kinase 1 [ Homo sapiens ]
Official Symbol GRK1
Synonyms GRK1; G protein-coupled receptor kinase 1; rhodopsin kinase, RHOK; rhodopsin kinase; GPRK1; RK; RHOK;
Gene ID 6011
mRNA Refseq NM_002929
Protein Refseq NP_002920
MIM 180381
UniProt ID Q15835

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRK1 Products

Required fields are marked with *

My Review for All GRK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon