Recombinant Human GRK1 Protein, GST-tagged

Description :	This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.63 kDa
AA Sequence :	RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	GRK1 G protein-coupled receptor kinase 1 [ Homo sapiens ]
Official Symbol	GRK1
Synonyms	GRK1; G protein-coupled receptor kinase 1; rhodopsin kinase, RHOK; rhodopsin kinase; GPRK1; RK; RHOK;
Gene ID	6011
mRNA Refseq	NM_002929
Protein Refseq	NP_002920
MIM	180381
UniProt ID	Q15835