Recombinant Human GRK1 Protein, GST-tagged

• Cat.No.: GRK1-5352H
• Product Overview: Human GRK1 partial ORF ( NP_002920.1, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRK1 G protein-coupled receptor kinase 1 [ Homo sapiens ]
• Official Symbol: GRK1
• Synonyms: GRK1; G protein-coupled receptor kinase 1; rhodopsin kinase, RHOK; rhodopsin kinase; GPRK1; RK; RHOK
• Gene ID: 6011
• mRNA Refseq: NM_002929
• Protein Refseq: NP_002920
• MIM: 180381
• UniProt ID: Q15835